PDB entry 1nza

View 1nza on RCSB PDB site
Description: Divalent cation tolerance protein (Cut A1) from thermus thermophilus HB8
Deposited on 2003-02-17, released 2003-03-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-03-11, with a file datestamp of 2003-03-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.229
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nzaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nzaA (A:)
    meevvlitvpseevartiakalveerlaacvnivpgltsiyrwqgevvedqellllvktt
    thafpklkervkalhpytvpeivalpiaegnreyldwlrentg