PDB entry 1nz9

View 1nz9 on RCSB PDB site
Description: solution structure of the n-utilization substance g (nusg) c-terminal (ngc) domain from thermus thermophilus
Deposited on 2003-02-17, released 2004-04-06
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: NMR31
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nz9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nz9A (A:)
    aqvafregdqvrvvsgpfadftgtvteinpergkvkvmvtifgretpveldfsqvvka