PDB entry 1nz5

View 1nz5 on RCSB PDB site
Description: the horse heart myoglobin variant k45e/k63e complexed with manganese
Deposited on 2003-02-15, released 2003-04-08
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-13, with a file datestamp of 2004-01-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.175
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nz5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nz5A (A:)
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdefkhlkteaemkased
lkehgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg