PDB entry 1nz3

View 1nz3 on RCSB PDB site
Description: K45E-K63E Variant of Horse Heart Myoglobin
Class: oxygen storage/transport
Keywords: Horse heart myoglobin, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2003-02-15, released 2003-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.181
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (0-152)
      • engineered (44)
      • engineered (62)
    Domains in SCOPe 2.05: d1nz3a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nz3A (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdefkhlkteaemkased
    lkehgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg