PDB entry 1nz2

View 1nz2 on RCSB PDB site
Description: K45E Variant of Horse Heart Myoglobin
Class: oxygen storage/transport
Keywords: muscle, oxygen transport, heme, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2003-02-15, released 2003-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.165
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (0-152)
      • engineered (44)
    Domains in SCOPe 2.06: d1nz2a_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nz2A (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdefkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg