PDB entry 1nz0

View 1nz0 on RCSB PDB site
Description: RNAse p protein from thermotoga maritima
Class: hydrolase
Keywords: ENDONUCLEASE, RNASE, ALFA-BETA SANDWICH, DIMER, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, HYDROLASE
Deposited on 2003-02-14, released 2003-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.163
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease P protein component
    Species: Thermotoga maritima [TaxId:2336]
    Gene: RNPA OR TM1463
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nz0a_
  • Chain 'B':
    Compound: Ribonuclease P protein component
    Species: Thermotoga maritima [TaxId:2336]
    Gene: RNPA OR TM1463
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nz0b_
  • Chain 'C':
    Compound: Ribonuclease P protein component
    Species: Thermotoga maritima [TaxId:2336]
    Gene: RNPA OR TM1463
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nz0c_
  • Chain 'D':
    Compound: Ribonuclease P protein component
    Species: Thermotoga maritima [TaxId:2336]
    Gene: RNPA OR TM1463
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nz0d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nz0A (A:)
    gstesftrrerlrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatr
    rnklkrwvreifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nz0A (A:)
    erlrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatrrnklkrwvr
    eifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nz0B (B:)
    gstesftrrerlrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatr
    rnklkrwvreifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nz0B (B:)
    rerlrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatrrnklkrwv
    reifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nz0C (C:)
    gstesftrrerlrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatr
    rnklkrwvreifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nz0C (C:)
    lrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatrrnklkrwvrei
    frrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nz0D (D:)
    gstesftrrerlrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatr
    rnklkrwvreifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nz0D (D:)
    rrerlrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatrrnklkrw
    vreifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg