PDB entry 1nyt

View 1nyt on RCSB PDB site
Description: SHIKIMATE DEHYDROGENASE AroE COMPLEXED WITH NADP+
Class: oxidoreductase
Keywords: alpha/beta domains, wide cleft separation, OXIDOREDUCTASE
Deposited on 2003-02-13, released 2003-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.136
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate 5-dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: aroE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nyta1, d1nyta2
  • Chain 'B':
    Compound: Shikimate 5-dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: aroE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nytb1, d1nytb2
  • Chain 'C':
    Compound: Shikimate 5-dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: aroE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nytc1, d1nytc2
  • Chain 'D':
    Compound: Shikimate 5-dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: aroE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nytd1, d1nytd2
  • Heterogens: SO4, NAP, DTV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nytA (A:)
    metyavfgnpiahskspfihqqfaqqlniehpygrvlapindfintlnaffsaggkganv
    tvpfkeeafaradelteraalagavntlmrledgrllgdntdgvgllsdlerlsfirpgl
    rilligaggasrgvllpllsldcavtitnrtvsraeelaklfahtgsiqalsmdeleghe
    fdliinatssgisgdipaipsslihpgiycydmfyqkgktpflawceqrgskrnadglgm
    lvaqaahafllwhgvlpdvepvikqlqeels
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nytB (B:)
    metyavfgnpiahskspfihqqfaqqlniehpygrvlapindfintlnaffsaggkganv
    tvpfkeeafaradelteraalagavntlmrledgrllgdntdgvgllsdlerlsfirpgl
    rilligaggasrgvllpllsldcavtitnrtvsraeelaklfahtgsiqalsmdeleghe
    fdliinatssgisgdipaipsslihpgiycydmfyqkgktpflawceqrgskrnadglgm
    lvaqaahafllwhgvlpdvepvikqlqeels
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nytC (C:)
    metyavfgnpiahskspfihqqfaqqlniehpygrvlapindfintlnaffsaggkganv
    tvpfkeeafaradelteraalagavntlmrledgrllgdntdgvgllsdlerlsfirpgl
    rilligaggasrgvllpllsldcavtitnrtvsraeelaklfahtgsiqalsmdeleghe
    fdliinatssgisgdipaipsslihpgiycydmfyqkgktpflawceqrgskrnadglgm
    lvaqaahafllwhgvlpdvepvikqlqeels
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nytC (C:)
    metyavfgnpiahskspfihqqfaqqlniehpygrvlapindfintlnaffsaggkganv
    tvpfkeeafaradelteraalagavntlmrledgrllgdntdgvgllsdlerlsfirpgl
    rilligaggasrgvllpllsldcavtitnrtvsraeelaklfahtgsiqalsmdeleghe
    fdliinatssgisgdipaipsslihpgiycydmfyqkgktpflawceqrgskrnadglgm
    lvaqaahafllwhgvlpdvepvikqlqee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nytD (D:)
    metyavfgnpiahskspfihqqfaqqlniehpygrvlapindfintlnaffsaggkganv
    tvpfkeeafaradelteraalagavntlmrledgrllgdntdgvgllsdlerlsfirpgl
    rilligaggasrgvllpllsldcavtitnrtvsraeelaklfahtgsiqalsmdeleghe
    fdliinatssgisgdipaipsslihpgiycydmfyqkgktpflawceqrgskrnadglgm
    lvaqaahafllwhgvlpdvepvikqlqeels
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nytD (D:)
    metyavfgnpiahskspfihqqfaqqlniehpygrvlapindfintlnaffsaggkganv
    tvpfkeeafaradelteraalagavntlmrledgrllgdntdgvgllsdlerlsfirpgl
    rilligaggasrgvllpllsldcavtitnrtvsraeelaklfahtgsiqalsmdeleghe
    fdliinatssgisgdipaipsslihpgiycydmfyqkgktpflawceqrgskrnadglgm
    lvaqaahafllwhgvlpdvepvikqlqeel