PDB entry 1nyr

View 1nyr on RCSB PDB site
Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with ATP
Deposited on 2003-02-13, released 2003-10-28
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-28, with a file datestamp of 2003-10-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.239
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nyrA (A:)
    meqiniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsie
    ivtpgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfe
    qiektmkqivnenmkierkvvsrdeakelfsndeyklelidaipedenvtlysqgdftdl
    crgvhvpstakikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerke
    rdhrkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlan
    vdlyktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriael
    gtmhryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysf
    rlsyrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktam
    gkeetlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflteetkgafp
    twlapkqvqiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykireaqmqkipyq
    ivvgdkevennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nyrA (A:)
    iniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsieivt
    pgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfeqie
    ktmkqivnenmkierkvvsrdeakelfsndeyklelidaipedenvtlysqgdftdlcrg
    vhvpstakikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerkerdh
    rkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlanvdl
    yktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriaelgtm
    hryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysfrls
    yrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktamgke
    etlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflteetkgafptwl
    apkqvqiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykireaqmqkipyqivv
    gdkevennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nyrB (B:)
    meqiniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsie
    ivtpgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfe
    qiektmkqivnenmkierkvvsrdeakelfsndeyklelidaipedenvtlysqgdftdl
    crgvhvpstakikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerke
    rdhrkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlan
    vdlyktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriael
    gtmhryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysf
    rlsyrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktam
    gkeetlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflteetkgafp
    twlapkqvqiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykireaqmqkipyq
    ivvgdkevennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nyrB (B:)
    meqiniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsie
    ivtpgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfe
    qiektmkqivnenmkierkvvsrdeakelelidaipedenvtlysqgdftdlcrgvhvps
    takikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerkerdhrkigk
    elelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlanvdlyktsg
    hwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriaelgtmhryea
    sgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysfrlsyrdpe
    dkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktamgkeetlst
    aqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflteetkgafptwlapkqv
    qiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykireaqmqkipyqivvgdkev
    ennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr