PDB entry 1nyr

View 1nyr on RCSB PDB site
Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with ATP
Class: ligase
Keywords: threonyl-tRNA synthetase, ATP, threonine, LIGASE
Deposited on 2003-02-13, released 2003-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.239
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonyl-tRNA synthetase 1
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nyra1, d1nyra2, d1nyra3, d1nyra4
  • Chain 'B':
    Compound: threonyl-tRNA synthetase 1
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nyrb1, d1nyrb2, d1nyrb3, d1nyrb4
  • Heterogens: ZN, ATP, THR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nyrA (A:)
    meqiniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsie
    ivtpgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfe
    qiektmkqivnenmkierkvvsrdeakelfsndeyklelidaipedenvtlysqgdftdl
    crgvhvpstakikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerke
    rdhrkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlan
    vdlyktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriael
    gtmhryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysf
    rlsyrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktam
    gkeetlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflteetkgafp
    twlapkqvqiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykireaqmqkipyq
    ivvgdkevennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nyrA (A:)
    iniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsieivt
    pgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfeqie
    ktmkqivnenmkierkvvsrdeakelfsndeyklelidaipedenvtlysqgdftdlcrg
    vhvpstakikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerkerdh
    rkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlanvdl
    yktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriaelgtm
    hryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysfrls
    yrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktamgke
    etlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflteetkgafptwl
    apkqvqiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykireaqmqkipyqivv
    gdkevennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nyrB (B:)
    meqiniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsie
    ivtpgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfe
    qiektmkqivnenmkierkvvsrdeakelfsndeyklelidaipedenvtlysqgdftdl
    crgvhvpstakikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerke
    rdhrkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlan
    vdlyktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriael
    gtmhryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysf
    rlsyrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktam
    gkeetlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflteetkgafp
    twlapkqvqiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykireaqmqkipyq
    ivvgdkevennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nyrB (B:)
    meqiniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsie
    ivtpgseealevlrhstahlmahaikrlygnvkfgvgpvieggfyydfdidqnissddfe
    qiektmkqivnenmkierkvvsrdeakelelidaipedenvtlysqgdftdlcrgvhvps
    takikefkllstagaywrgdsnnkmlqriygtaffdkkelkahlqmleerkerdhrkigk
    elelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlanvdlyktsg
    hwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriaelgtmhryea
    sgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysfrlsyrdpe
    dkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktamgkeetlst
    aqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflteetkgafptwlapkqv
    qiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykireaqmqkipyqivvgdkev
    ennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr