PDB entry 1nyp

View 1nyp on RCSB PDB site
Description: 4th LIM domain of PINCH protein
Class: cell adhesion
Keywords: LIM domain, protein recognition, CELL ADHESION
Deposited on 2003-02-13, released 2003-07-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PINCH protein
    Species: Homo sapiens [TaxId:9606]
    Gene: LIMS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48059 (2-65)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1nypa1, d1nypa2, d1nypa3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nypA (A:)
    gsmgvpicgacrrpiegrvvnamgkqwhvehfvcakcekpflghrhyerkglaycethyn
    qlfgdv