PDB entry 1nyp

View 1nyp on RCSB PDB site
Description: 4th LIM domain of PINCH protein
Class: cell adhesion
Keywords: LIM domain, protein recognition
Deposited on 2003-02-13, released 2003-07-01
The last revision prior to the SCOP 1.75 freeze date was dated 2003-07-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PINCH protein
  Species: HOMO SAPIENS
  Gene: LIMS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48059 (2-65)
    • cloning artifact (0-1)
  Domains in SCOP 1.75: d1nypa1, d1nypa2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nypA (A:)
  gsmgvpicgacrrpiegrvvnamgkqwhvehfvcakcekpflghrhyerkglaycethyn
  qlfgdv