PDB entry 1nyo

View 1nyo on RCSB PDB site
Description: Solution structure of the antigenic TB protein MPT70/MPB70
Deposited on 2003-02-13, released 2003-08-19
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: NMR38
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nyoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nyoA (A:)
    gdlvgpgcaeyaaanptgpasvqgmsqdpvavaasnnpelttltaalsgqlnpqvnlvdt
    lnsgqytvfaptnaafsklpastidelktnsslltsiltyhvvagqtspanvvgtrqtlq
    gasvtvtgqgnslkvgnadvvcggvstanatvymidsvlmppa