PDB entry 1nyo

View 1nyo on RCSB PDB site
Description: Solution structure of the antigenic TB protein MPT70/MPB70
Class: immune system
Keywords: seven-stranded beta-barrel, fasciclin domain, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, IMMUNE SYSTEM
Deposited on 2003-02-13, released 2003-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunogenic protein MPT70
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: mpt70/mpb70
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nyoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nyoA (A:)
    gdlvgpgcaeyaaanptgpasvqgmsqdpvavaasnnpelttltaalsgqlnpqvnlvdt
    lnsgqytvfaptnaafsklpastidelktnsslltsiltyhvvagqtspanvvgtrqtlq
    gasvtvtgqgnslkvgnadvvcggvstanatvymidsvlmppa