PDB entry 1nyn

View 1nyn on RCSB PDB site
Description: Solution NMR Structure of Protein YHR087W from Saccharomyces cerevisiae. Northeast Structural Genomics Consortium Target YTYST425.
Class: structural genomics, unknown function
Keywords: hypothetical protein, structural genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2003-02-13, released 2003-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical 12.0 kDa protein in NAM8-GAR1 intergenic region
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: YHR087W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38804 (20-130)
  Domains in SCOPe 2.08: d1nyna_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1nynA (A:)
  mgsshhhhhhssglvprgshmstvtkyfykgentdlivfaaseelvdeylknpsigklse
  vvelfevftpqdgrgaegelgaaskaqvenefgkgkkieevidlilrngkpnsttsslkt
  kggnagtkayn
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1nynA (A:)
  mstvtkyfykgentdlivfaaseelvdeylknpsigklsevvelfevftpqdgrgaegel
  gaaskaqvenefgkgkkieevidlilrngkpnsttsslktkggnagtkayn