PDB entry 1nym

View 1nym on RCSB PDB site
Description: Crystal Structure of the complex between M182T mutant of TEM-1 and a boronic acid inhibitor (CXB)
Class: hydrolase
Keywords: Antibiotic resistance, beta-lactamase, acylation transition-state analog, crystal structure
Deposited on 2003-02-12, released 2003-08-26
The last revision prior to the SCOP 1.75 freeze date was dated 2003-08-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.106
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered (156)
    Domains in SCOP 1.75: d1nyma_
  • Heterogens: K, PO4, CXB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nymA (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw