PDB entry 1nyc
View 1nyc on RCSB PDB site
Description: Staphostatins resemble lipocalins, not cystatins in fold.
Class: hydrolase inhibitor
Keywords: Staphostatin B, SspC, cysteine protease inhibitor, HYDROLASE INHIBITOR
Deposited on
2003-02-12, released
2003-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.202
AEROSPACI score: 0.67
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: cysteine protease Inhibitor
Species: Staphylococcus aureus [TaxId:196620]
Gene: staphostatin B (sspC)
Database cross-references and differences (RAF-indexed):
- Uniprot Q7A189 (2-110)
- cloning artifact (0-1)
- see remark 999 (71)
Domains in SCOPe 2.06: d1nyca1, d1nyca2 - Chain 'B':
Compound: cysteine protease Inhibitor
Species: Staphylococcus aureus [TaxId:196620]
Gene: staphostatin B (sspC)
Database cross-references and differences (RAF-indexed):
- Uniprot Q7A189 (2-110)
- cloning artifact (0-1)
- see remark 999 (71)
Domains in SCOPe 2.06: d1nycb1, d1nycb2 - Heterogens: CL, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1nycA (A:)
gsmyqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfi
dtahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1nycB (B:)
gsmyqlqfinlvydttklthleqtninlfignwsnhqlqksicirhgddtshnqyhilfi
dtahqrikfssfdneeiiyildyddtqhilmqtsskqgigtsrpivyerlv