PDB entry 1ny8

View 1ny8 on RCSB PDB site
Description: solution structure of protein yrba from escherichia coli: northeast structural genomics consortium target er115
Deposited on 2003-02-11, released 2004-06-15
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-15, with a file datestamp of 2004-06-15.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1ny8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ny8A (A:)
  miedpmenneiqsvlmnalslqevhvsgdgshfqviavgelfdgmsrvkkqqtvygplme
  yiadnrihavsikaytpaewardrklngflehhhhhh