PDB entry 1ny6

View 1ny6 on RCSB PDB site
Description: Crystal structure of sigm54 activator (AAA+ ATPase) in the active state
Class: transcription
Keywords: AAA+ ATPase, sigma54 activator, bacterial transcription, heptamer
Deposited on 2003-02-11, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.266
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ny6a_
  • Chain 'B':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ny6b_
  • Chain 'C':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ny6c_
  • Chain 'D':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ny6d_
  • Chain 'E':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ny6e_
  • Chain 'F':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ny6f_
  • Chain 'G':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ny6g_
  • Chain 'H':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ny6h_
  • Chain 'I':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ny6i_
  • Chain 'J':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ny6j_
  • Chain 'K':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ny6k_
  • Chain 'L':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ny6l_
  • Chain 'M':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ny6m_
  • Chain 'N':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ny6n_
  • Heterogens: ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ny6A (A:)
    mrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny6A (A:)
    eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
    siprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvies
    gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
    iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
    gelsclv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ny6B (B:)
    mrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny6B (B:)
    espkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnvasipr
    difeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrviesgkfy
    rlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkediipla
    nhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidrgels
    clv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ny6C (C:)
    mrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny6C (C:)
    eeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnv
    asiprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvie
    sgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerked
    iiplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfid
    rgelsclv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ny6D (D:)
    mrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny6D (D:)
    eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
    siprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvies
    gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
    iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
    gelsclv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ny6E (E:)
    mrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny6E (E:)
    eeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnv
    asiprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvie
    sgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerked
    iiplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfid
    rgelsclv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ny6F (F:)
    mrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny6F (F:)
    eeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnv
    asiprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvie
    sgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerked
    iiplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfid
    rgelsclv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ny6G (G:)
    mrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny6G (G:)
    eeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnv
    asiprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvie
    sgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerked
    iiplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfid
    rgelsclv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ny6H (H:)
    mrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny6H (H:)
    eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
    siprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvies
    gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
    iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
    gelsc
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ny6I (I:)
    mrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny6I (I:)
    eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
    siprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvies
    gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
    iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
    gelsclv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ny6J (J:)
    mrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny6J (J:)
    eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
    siprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvies
    gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
    iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
    gelsclv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1ny6K (K:)
    mrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny6K (K:)
    eeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnv
    asiprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvie
    sgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerked
    iiplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfid
    rgelsclv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ny6L (L:)
    mrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny6L (L:)
    eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
    siprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvies
    gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
    iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
    gelscl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1ny6M (M:)
    mrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny6M (M:)
    eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
    siprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvies
    gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
    iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
    gelsclv
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1ny6N (N:)
    mrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny6N (N:)
    eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
    siprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvies
    gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
    iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
    gelsclv