PDB entry 1ny5

View 1ny5 on RCSB PDB site
Description: Crystal structure of sigm54 activator (AAA+ ATPase) in the inactive state
Class: transcription
Keywords: AAA+ ATPase, sigma54 activator, bacterial transcription, dimer, TRANSCRIPTION
Deposited on 2003-02-11, released 2003-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ny5a1, d1ny5a2
  • Chain 'B':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ny5b1, d1ny5b2
  • Heterogens: MG, PO4, ADP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ny5A (A:)
    mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
    eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
    lrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny5A (A:)
    mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
    eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
    lrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ny5B (B:)
    mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
    eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
    lrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny5B (B:)
    mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
    eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
    lrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvn