PDB entry 1ny4

View 1ny4 on RCSB PDB site
Description: solution structure of the 30s ribosomal protein s28e from pyrococcus horikoshii. northeast structural genomics consortium target jr19.
Deposited on 2003-02-11, released 2003-09-02
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ny4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ny4A (A:)
maedegypaevieiigrtgttgdvtqvkvrilegrdkgrvirrnvrgpvrvgdililret
ereareiksrraaalehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1ny4A (A:)
maedegypaevieiigrtgttgdvtqvkvrilegrdkgrvirrnvrgpvrvgdililret
ereareiksrr