PDB entry 1ny4

View 1ny4 on RCSB PDB site
Description: Solution structure of the 30S ribosomal protein S28E from Pyrococcus horikoshii. Northeast Structural Genomics Consortium target JR19.
Class: RNA binding protein
Keywords: JR19, NMR structure, AUTOSTRUCTURE, Ribosomal protein, Northeast Structural Genomics Consortium, PSI, Protein Structure Initiative, NESG, RNA binding protein
Deposited on 2003-02-11, released 2003-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S28E
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: RPS28E
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ny4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ny4A (A:)
maedegypaevieiigrtgttgdvtqvkvrilegrdkgrvirrnvrgpvrvgdililret
ereareiksrraaalehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1ny4A (A:)
maedegypaevieiigrtgttgdvtqvkvrilegrdkgrvirrnvrgpvrvgdililret
ereareiksrr