PDB entry 1ny1

View 1ny1 on RCSB PDB site
Description: crystal structure of b. subtilis polysaccharide deacetylase northeast structural genomics consortium target sr127.
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, POLYSACCHARIDE DEAC, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2003-02-11, released 2003-03-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable polysaccharide deacetylase pdaA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PdaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34928 (0-End)
      • modified residue (90)
      • modified residue (185)
      • modified residue (229)
      • modified residue (234)
    Domains in SCOPe 2.03: d1ny1a_
  • Chain 'B':
    Compound: Probable polysaccharide deacetylase pdaA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PdaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34928 (0-End)
      • modified residue (90)
      • modified residue (185)
      • modified residue (229)
      • modified residue (234)
    Domains in SCOPe 2.03: d1ny1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ny1A (A:)
    vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
    vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
    dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
    yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemrlpsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny1A (A:)
    vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
    vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
    dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
    yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekem
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ny1B (B:)
    vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
    vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
    dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
    yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemrlpsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny1B (B:)
    vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
    vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
    dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
    yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekem