PDB entry 1ny1

View 1ny1 on RCSB PDB site
Description: crystal structure of b. subtilis polysaccharide deacetylase northeast structural genomics consortium target sr127.
Deposited on 2003-02-11, released 2003-03-18
The last revision prior to the SCOP 1.65 freeze date was dated 2003-03-18, with a file datestamp of 2003-03-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ny1a_
  • Chain 'B':
    Domains in SCOP 1.65: d1ny1b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ny1A (A:)
    vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
    vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
    dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
    yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemrlpsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny1A (A:)
    vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
    vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
    dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
    yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekem
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ny1B (B:)
    vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
    vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
    dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
    yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemrlpsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny1B (B:)
    vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
    vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
    dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
    yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekem