PDB entry 1ny0

View 1ny0 on RCSB PDB site
Description: Crystal Structure of the complex between M182T mutant of TEM-1 and a boronic acid inhibitor (NBF)
Class: hydrolase
Keywords: Antibiotic resistance, beta-lactamase, acylation transition-state analog, crystal structure, HYDROLASE
Deposited on 2003-02-11, released 2003-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.171
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered (156)
    Domains in SCOPe 2.07: d1ny0a_
  • Heterogens: PO4, K, NBF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ny0A (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw