PDB entry 1nxz

View 1nxz on RCSB PDB site
Description: X-Ray Crystal Structure of Protein yggj_haein of Haemophilus influenzae. Northeast Structural Genomics Consortium Target IR73.
Deposited on 2003-02-11, released 2003-03-11
The last revision prior to the SCOP 1.65 freeze date was dated 2003-03-11, with a file datestamp of 2003-03-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nxzA (A:)
    ripriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkks
    vkveilgreladkeshlkihlgqvisrgermeftiqksvelgvnvitplwsercgvklda
    ermdkkiqqwqkiaiaaceqcgrnivpeirplmklqdwcaendgalklnlhprahysikt
    lptipaggvrlligsegglsaqeiaqteqqgfteillgkrvlrtetaslaaisalqicfg
    dlgeaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nxzB (B:)
    ripriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkks
    vkveilgreladkeshlkihlgqvisrgermeftiqksvelgvnvitplwsercgvklda
    ermdkkiqqwqkiaiaaceqcgrnivpeirplmklqdwcaendgalklnlhprahysikt
    lptipaggvrlligsegglsaqeiaqteqqgfteillgkrvlrtetaslaaisalqicfg
    dlgeaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nxzB (B:)
    ripriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkks
    vkveilgreladkeshlkihlgqvisrgermeftiqksvelgvnvitplwsercgvklda
    ermdkkiqqwqkiaiaaceqcgrnivpeirplmklqdwcaendgalklnlhprahysikt
    lptipaggvrlligsegglsaqeiaqteqqgfteillgkrvlrtetaslaaisalqicfg
    dlgea