PDB entry 1nxx

View 1nxx on RCSB PDB site
Description: MicArec pH 5.5
Class: signaling protein
Keywords: doubly wound alpha-5, beta-5 fold, SIGNALING PROTEIN
Deposited on 2003-02-11, released 2004-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding response regulator
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nxxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nxxA (A:)
    mkkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidg
    levaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrrsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nxxA (A:)
    kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlidglevak
    tirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrrs