PDB entry 1nxq

View 1nxq on RCSB PDB site
Description: Crystal Structure of R-alcohol dehydrogenase (RADH) (apoenyzme) from Lactobacillus brevis
Class: oxidoreductase
Keywords: short chain dehydrogenases/reductases, SDR enzyme family, Rossmann fold, OXIDOREDUCTASE
Deposited on 2003-02-11, released 2003-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.151
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: R-alcohol dehydrogenase
    Species: LACTOBACILLUS BREVIS [TaxId:1580]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nxqa_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nxqA (A:)
    snrldgkvaiitggtlgiglaiatkfveegakvmitgrhsdvgekaaksvgtpdqiqffq
    hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
    trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
    efvvdggytaq