PDB entry 1nxf

View 1nxf on RCSB PDB site
Description: Ligand-linked transitions of deoxyHbI crystals exposed to CO.
Class: oxygen storage/transport
Keywords: Invertebrate, Hemoglobin, allostery, cooperative, oxygen-binding, oxygen transport, heme protein, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2003-02-10, released 2003-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Globin I
    Species: Scapharca inaequivalvis [TaxId:6561]
    Gene: HbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nxfa_
  • Chain 'B':
    Compound: Globin I
    Species: Scapharca inaequivalvis [TaxId:6561]
    Gene: HbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nxfb_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nxfA (A:)
    psvydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqg
    mandklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikk
    vlasknfgdkyanawaklvavvqaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nxfA (A:)
    svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
    andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
    lasknfgdkyanawaklvavvqaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nxfB (B:)
    psvydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqg
    mandklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikk
    vlasknfgdkyanawaklvavvqaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nxfB (B:)
    svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
    andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
    lasknfgdkyanawaklvavvqaal