PDB entry 1nx8

View 1nx8 on RCSB PDB site
Description: Structure of carbapenem synthase (CarC) complexed with N-acetyl proline
Class: unknown function
Keywords: jelly roll, UNKNOWN FUNCTION
Deposited on 2003-02-10, released 2003-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbapenem synthase
    Species: Pectobacterium carotovorum [TaxId:554]
    Gene: CarC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nx8a_
  • Chain 'B':
    Compound: Carbapenem synthase
    Species: Pectobacterium carotovorum [TaxId:554]
    Gene: CarC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nx8b_
  • Chain 'C':
    Compound: Carbapenem synthase
    Species: Pectobacterium carotovorum [TaxId:554]
    Gene: CarC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nx8c_
  • Heterogens: FE, AKG, N7P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nx8A (A:)
    mseivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysa
    ygtiveyadekigvgfgyrdtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaae
    iknvkfrgattvcdhalacqempahllrvleeetfevrvlergyyvdvspdgwfkvpvft
    dlgwvrkmliyfpfdegqpasweprivgftdhetqaffqelgaflkqpryyykhfwedgd
    llimdnrrvihereefndddivrrlyrgqtadi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nx8A (A:)
    seivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysay
    gtiveyrdtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaaeiknvkfrgattv
    cdhalacqempahllrvleeetfevrvlwfkvpvftdlgwvrkmliyfpfdegqpaswep
    rivgftdhetqaffqelgaflkqpryyykhfwedgdllimdnrrvihereefndddivrr
    lyrgqtad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nx8B (B:)
    mseivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysa
    ygtiveyadekigvgfgyrdtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaae
    iknvkfrgattvcdhalacqempahllrvleeetfevrvlergyyvdvspdgwfkvpvft
    dlgwvrkmliyfpfdegqpasweprivgftdhetqaffqelgaflkqpryyykhfwedgd
    llimdnrrvihereefndddivrrlyrgqtadi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nx8B (B:)
    seivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysay
    gtiveyagvgfgyrdtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaaeiknvk
    frgattvcdhalacqempahllrvleeetfevrvlgwfkvpvftdlgwvrkmliyfpfde
    gqpasweprivgftdhetqaffqelgaflkqpryyykhfwedgdllimdnrrvihereef
    ndddivrrlyrgqtad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nx8C (C:)
    mseivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysa
    ygtiveyadekigvgfgyrdtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaae
    iknvkfrgattvcdhalacqempahllrvleeetfevrvlergyyvdvspdgwfkvpvft
    dlgwvrkmliyfpfdegqpasweprivgftdhetqaffqelgaflkqpryyykhfwedgd
    llimdnrrvihereefndddivrrlyrgqtadi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nx8C (C:)
    seivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysay
    gtivedtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaaeiknvkfrgattvcd
    halacqempahllrvleeetfevrvlwfkvpvftdlgwvrkmliyfpfdegqpaswepri
    vgftdhetqaffqelgaflkqpryyykhfwedgdllimdnrrvihereefndddivrrly
    rgqtad