PDB entry 1nx7

View 1nx7 on RCSB PDB site
Description: Solution Structure of Oxidized Bovine Microsomal Cytochrome B5
Class: electron transport
Keywords: five helix, five sheet, heme ring, electron transport
Deposited on 2003-02-10, released 2004-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nx7a_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nx7A (A:)
    avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedvg
    hstdarelsktfiigelhpddr