PDB entry 1nwz

View 1nwz on RCSB PDB site
Description: pyp ultra-high resolution structure of a bacterial photoreceptor
Class: signaling protein
Keywords: PAS, LOV, GAF, domains fold
Deposited on 2003-02-07, released 2003-03-11
The last revision prior to the SCOP 1.73 freeze date was dated 2003-07-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 0.82 Å
R-factor: 0.123
AEROSPACI score: 1.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Photoactive yellow protein
  Species: Ectothiorhodospira halophila
  Gene: PYP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
  Domains in SCOP 1.73: d1nwza_
• Heterogens: HC4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nwzA (A:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv