PDB entry 1nwz

View 1nwz on RCSB PDB site
Description: PYP Ultra-high resolution structure of a Bacterial Photoreceptor
Deposited on 2003-02-07, released 2003-03-11
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-29, with a file datestamp of 2003-07-29.
Experiment type: XRAY
Resolution: 0.82 Å
R-factor: 0.123
AEROSPACI score: 1.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1nwza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nwzA (A:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
    nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv