PDB entry 1nwz

View 1nwz on RCSB PDB site
Description: PYP Ultra-high resolution structure of a Bacterial Photoreceptor
Class: signaling protein
Keywords: PAS, LOV, GAF, domains fold, SIGNALING PROTEIN
Deposited on 2003-02-07, released 2003-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 0.82 Å
R-factor: 0.123
AEROSPACI score: 1.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoactive yellow protein
    Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
    Gene: PYP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nwza_
  • Heterogens: HC4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nwzA (A:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
    nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv