PDB entry 1nwo

View 1nwo on RCSB PDB site
Description: crystallographic study of azurin from pseudomonas putida
Deposited on 1997-09-06, released 1998-01-28
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.169
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1nwoa_
  • Chain 'B':
    Domains in SCOP 1.55: d1nwob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nwoA (A:)
    aeckvtvdstdqmsfntkdiaidkscktftvelthsgslpknvmghnlviskeadmqpia
    tdglsagidkqylkdgdarviahtkvigagekdsvtfdvsklaagekygffcsfpghism
    mkgtvtlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nwoB (B:)
    aeckvtvdstdqmsfntkdiaidkscktftvelthsgslpknvmghnlviskeadmqpia
    tdglsagidkqylkdgdarviahtkvigagekdsvtfdvsklaagekygffcsfpghism
    mkgtvtlk