PDB entry 1nwj

View 1nwj on RCSB PDB site
Description: solution structure of hypothetical arabidopsis thaliana protein at3g17210. center for eukaryotic structural genomics target 13081
Class: structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-02-06, released 2003-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-08-19, with a file datestamp of 2007-04-25.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: expressed protein: At3g17210.1
    Species: Arabidopsis thaliana
    Database cross-references and differences (RAF-indexed):
    • GB NP_566569 (3-111)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1nwja1, d1nwja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nwjA (A:)
    gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
    qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl