PDB entry 1nwj

View 1nwj on RCSB PDB site
Description: solution structure of hypothetical arabidopsis thaliana protein at3g17210. center for eukaryotic structural genomics target 13081
Deposited on 2003-02-06, released 2003-06-03
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-03, with a file datestamp of 2003-06-03.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1nwja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nwjA (A:)
    gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
    qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl