PDB entry 1nwh

View 1nwh on RCSB PDB site
Description: Crystal Structure of Aspartate Semialdehyde Dehydrogenase from Haemophilus influenzae as a Tetrahedral Hemithioacetal Reaction Intermediate at 2.0 A
Class: oxidoreductase
Keywords: aspartate semialdehyde dehydrogenase, aspartate semialdehyde, Haemophilus influenzae, tetrahedral intermediate, hemithioacetal, OXIDOREDUCTASE
Deposited on 2003-02-06, released 2003-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: ASD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44801 (0-370)
      • modified residue (135)
    Domains in SCOPe 2.06: d1nwha1, d1nwha2
  • Chain 'B':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: ASD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44801 (0-370)
      • modified residue (135)
    Domains in SCOPe 2.06: d1nwhb1, d1nwhb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nwhA (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkeewkgyaetnkilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwhA (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqlksafdieelkkldiivtcqg
    gdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvggn
    ctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkdpa
    ssildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnkil
    glsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndkeit
    lreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaaepvrrilkqlva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nwhB (B:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkeewkgyaetnkilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwhB (B:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqlksafdieelkkldiivtcqg
    gdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvggn
    ctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkdpa
    ssildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnkil
    glsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndkeit
    lreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaaepvrrilkqlva