PDB entry 1nwe
View 1nwe on RCSB PDB site
Description: Ptp1B R47C Modified at C47 with N-[4-(2-{2-[3-(2-Bromo-acetylamino)-propionylamino]-3-hydroxy-propionylamino}-ethyl)-phenyl]-oxalamic acid
Class: hydrolase
Keywords: hydrolase, Acetylation, Phosphorylation, phospatase, phosphotyrosine mimetic
Deposited on 
2003-02-06, released 
2003-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 
2017-10-11, with a file datestamp of 
2017-10-06.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
 Compound: protein-tyrosine phosphatase, non-receptor type 1
 Species: Homo sapiens [TaxId:9606]
 Gene: PTPN1
 Database cross-references and differences (RAF-indexed):
- Uniprot P18031
- engineered (31)
- engineered (46)
- engineered (91)
 
 Domains in SCOPe 2.08: d1nwea_
- Heterogens: FG1
PDB Chain Sequences:
- Chain 'A':
 Sequence, based on SEQRES records: (download)
 
>1nweA (A:)
memekefeqidksgswaaiyqdirheasdfpsrvaklpknknrnrycdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntvghfwemvweqksrgvvmlnrvmekgslk
caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
 
 Sequence, based on observed residues (ATOM records): (download)
 
>1nweA (A:)
emekefeqidksgswaaiyqdirheasdfpsrvaklpknknrnrycdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntvghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshe