PDB entry 1nwc

View 1nwc on RCSB PDB site
Description: Crystal Structure of Aspartate-Semialdehyde Dehydrogenase from Haemophilus influenzae
Class: oxidoreductase
Keywords: enzyme, aspartate-semialdehyde dehydrogenase, Haemophilus influenzae, OXIDOREDUCTASE
Deposited on 2003-02-05, released 2003-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: ASD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nwca1, d1nwca2
  • Chain 'B':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: ASD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nwcb1, d1nwcb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nwcA (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkeewkgyaetnkilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwcA (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqlksafdieelkkldiivtcqg
    gdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvggn
    ctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkdpa
    ssildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnkil
    glsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndkeit
    lreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaaepvrrilkqlva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nwcB (B:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkeewkgyaetnkilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwcB (B:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqlksafdieelkkldiivtcqg
    gdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvggn
    ctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkdpa
    ssildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnkil
    glsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndkeit
    lreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaaepvrrilkqlva