PDB entry 1nwc

View 1nwc on RCSB PDB site
Description: Crystal Structure of Aspartate-Semialdehyde Dehydrogenase from Haemophilus influenzae
Deposited on 2003-02-05, released 2003-11-04
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-04, with a file datestamp of 2003-11-04.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nwcA (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkeewkgyaetnkilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwcA (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqlksafdieelkkldiivtcqg
    gdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvggn
    ctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkdpa
    ssildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnkil
    glsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndkeit
    lreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaaepvrrilkqlva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nwcB (B:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkeewkgyaetnkilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwcB (B:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqlksafdieelkkldiivtcqg
    gdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvggn
    ctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkdpa
    ssildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnkil
    glsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndkeit
    lreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaaepvrrilkqlva