PDB entry 1nw1

View 1nw1 on RCSB PDB site
Description: Crystal Structure of Choline Kinase
Class: transferase
Keywords: choline kinase, phospholipid synthesis, protein kinase fold, TRANSFERASE
Deposited on 2003-02-05, released 2003-06-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.209
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Choline kinase (49.2 kD)
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1nw1a_
  • Chain 'B':
    Compound: Choline kinase (49.2 kD)
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1nw1b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nw1A (A:)
    mssrkvsrahydedelasaanmslvaeghfrgmkellstmdldtdantipelkerahmlc
    arflggawktvplehlrisrikggmsnmlflcrlsevyppirnepnkvllrvyfnpetes
    hlvaesviftllserhlgpklygifsggrleeyipsrplscheislahmstkiakrvakv
    hqlevpiwkepdylcealqrwlkqltgtvdaehrfdlpeecgvssvncldlareleflra
    hislskspvtfchndlqegnillpkassgnirmpslsdetqalgnslsafnpadprlvli
    dfeyasynyrafdfanhfiewtidydideapfykiqtenfpendqmlefflnylreqgnt
    renelykksedlvqetlpfvpvshffwgvwgllqvelspvgfgfadygrdrlslyfkhkq
    llknlashq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nw1A (A:)
    gmkellstmdldtdantipelkerahmlcarflggawktvplehlrisrikggmsnmlfl
    crlsevyppirnepnkvllrvyfnpeteshlvaesviftllserhlgpklygifsggrle
    eyipsrplscheislahmstkiakrvakvhqlevpiwkepdylcealqrwlkqltgtvda
    ehrfdlpeecgvssvncldlareleflrahislskspvtfchndlqegnillpkrlvlid
    feyasynyrafdfanhfiewtidydideapfykiqtenfpendqmlefflnylreqgntr
    enelykksedlvqetlpfvpvshffwgvwgllqvelspvgfgfadygrdrlslyfkhkql
    lknla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nw1B (B:)
    mssrkvsrahydedelasaanmslvaeghfrgmkellstmdldtdantipelkerahmlc
    arflggawktvplehlrisrikggmsnmlflcrlsevyppirnepnkvllrvyfnpetes
    hlvaesviftllserhlgpklygifsggrleeyipsrplscheislahmstkiakrvakv
    hqlevpiwkepdylcealqrwlkqltgtvdaehrfdlpeecgvssvncldlareleflra
    hislskspvtfchndlqegnillpkassgnirmpslsdetqalgnslsafnpadprlvli
    dfeyasynyrafdfanhfiewtidydideapfykiqtenfpendqmlefflnylreqgnt
    renelykksedlvqetlpfvpvshffwgvwgllqvelspvgfgfadygrdrlslyfkhkq
    llknlashq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nw1B (B:)
    mdldtdantipelkerahmlcarflggawktvplehlrisrikggmsnmlflcrlsevyp
    pirnepnkvllrvyfnpeteshlvaesviftllserhlgpklygifsggrleeyipsrpl
    scheislahmstkiakrvakvhqlevpiwkepdylcealqrwlkqltgtvdaehrfdlpe
    ecgvssvncldlareleflrahislskspvtfchndlqegnillpkrlvlidfeyasyny
    rafdfanhfiewtidydideapfykiqtenfpendqmlefflnylreqgntrenelykks
    edlvqetlpfvpvshffwgvwgllqvelspvgfgfadygrdrlslyfkhkqllknla