PDB entry 1nvu

View 1nvu on RCSB PDB site
Description: Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS
Class: signaling protein
Keywords: proto-oncogene, GTP binding, Guanine nucleotide release factor, SIGNALING PROTEIN
Deposited on 2003-02-04, released 2003-04-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'Q':
    Compound: transforming protein p21/h-ras-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS OR HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered (58)
    Domains in SCOPe 2.01: d1nvuq_
  • Chain 'R':
    Compound: transforming protein p21/h-ras-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS OR HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered (58)
    Domains in SCOPe 2.01: d1nvur_
  • Chain 'S':
    Compound: Son of sevenless protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SOS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1nvus_
  • Heterogens: MG, PO4, GTP, HOH

PDB Chain Sequences:

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nvuQ (Q:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtgg
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nvuR (R:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtgg
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1nvuS (S:)
    qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
    tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
    qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
    ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
    gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
    nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
    cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
    dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvuS (S:)
    qmrlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtfltty
    rsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvln
    vcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiahnitfqss
    pptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkein
    spnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsa
    mnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltni
    lkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpm
    gnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr