PDB entry 1nvu

View 1nvu on RCSB PDB site
Description: structural evidence for feedback activation by rasgtp of the ras- specific nucleotide exchange factor sos
Deposited on 2003-02-04, released 2003-04-01
The last revision prior to the SCOP 1.67 freeze date was dated 2003-04-01, with a file datestamp of 2003-04-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'Q':
    Domains in SCOP 1.67: d1nvuq_
  • Chain 'R':
    Domains in SCOP 1.67: d1nvur_
  • Chain 'S':
    Domains in SCOP 1.67: d1nvus_

PDB Chain Sequences:

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nvuQ (Q:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtgg
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nvuR (R:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtgg
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1nvuS (S:)
    qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
    tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
    qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
    ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
    gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
    nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
    cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
    dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvuS (S:)
    qmrlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtfltty
    rsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvln
    vcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiahnitfqss
    pptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkein
    spnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsa
    mnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltni
    lkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpm
    gnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr