PDB entry 1nvp

View 1nvp on RCSB PDB site
Description: human tfiia/tbp/DNA complex
Class: transcription/DNA
Keywords: transcription regulation, DNA, complex, transcription/DNA complex
Deposited on 2003-02-04, released 2003-10-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tata box binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TBP OR TFIID OR TF2D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1nvpa1, d1nvpa2
  • Chain 'B':
    Compound: Transcription initiation factor IIA alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2A1 OR TF2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1nvpb_
  • Chain 'C':
    Compound: Transcription initiation factor IIA beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2A1 OR TF2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1nvpc_
  • Chain 'D':
    Compound: Transcription initiation factor IIA gamma chain
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2A2 OR TF2A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1nvpd1, d1nvpd2
  • Chain 'E':
    Compound: 5'-d(*gp*gp*gp*gp*gp*gp*gp*cp*tp*ap*tp*ap*ap*ap*ap*gp*g)-3'
    Species:
    Gene:
  • Chain 'F':
    Compound: 5'-d(*cp*cp*tp*tp*tp*tp*ap*tp*ap*gp*cp*cp*cp*cp*cp*cp*c)-3'
    Species:
    Gene:
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nvpA (A:)
    sgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssgk
    mvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlthq
    qfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrkt
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvpA (A:)
    sgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssgk
    mvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlthq
    qfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nvpB (B:)
    ansantntvpklyrsviedvindvrdiflddgvdeqvlmelktlwenklmqsravdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvpB (B:)
    tvpklyrsviedvindvrdiflddgvdeqvlmelktlwenklm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nvpC (C:)
    gsgaedgqveeeplnseddvsdeegqelfdtenvvvcqydkihrsknkwkfhlkdgimnl
    ngrdyifskaigdaew
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvpC (C:)
    dtenvvvcqydkihrsknkwkfhlkdgimnlngrdyifskaigdaew
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nvpD (D:)
    ayqlyrnttlgnslqesldeliqsqqitpqlalqvllqfdkainaalaqrvrnrvnfrgs
    lntyrfcdnvwtfvlndvefrevtelikvdkvkivacdgkntgsntte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvpD (D:)
    yqlyrnttlgnslqesldeliqsqqitpqlalqvllqfdkainaalaqrvrnrvnfrgsl
    ntyrfcdnvwtfvlndvefrevtelikvdkvkivacd
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.