PDB entry 1nvk

View 1nvk on RCSB PDB site
Description: T4 phage BGT in complex with UDP and a Mn2+ ion at 1.8 A resolution
Class: transferase
Keywords: glycosyltransferase, GT-B, Mn, TRANSFERASE
Deposited on 2003-02-04, released 2003-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA beta-glucosyltransferase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: BGT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nvka_
  • Heterogens: MN, UDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nvkA (A:)
    mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
    rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
    yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
    tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
    nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
    nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl