PDB entry 1nvi

View 1nvi on RCSB PDB site
Description: Orthorhombic Crystal Form of Molybdopterin Synthase
Class: transferase
Keywords: Protein-Protein Complex, Molybdenum cofactor biosynthesis, transferase
Deposited on 2003-02-03, released 2003-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Molybdopterin converting factor subunit 1
    Species: Escherichia coli [TaxId:562]
    Gene: MOAD OR CHLA4 OR CHLM OR B0784
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30748 (0-80)
      • engineered (1)
    Domains in SCOPe 2.08: d1nvid_
  • Chain 'E':
    Compound: Molybdopterin converting factor subunit 2
    Species: Escherichia coli [TaxId:562]
    Gene: MOAE OR CHLA5 OR B0785
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nvie_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nviD (D:)
    mvkvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
    sfdhpltdgdevaffppvtgg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nviE (E:)
    maetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmte
    kalaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylkt
    rapfwkreatpegdrwvearesdqqaakrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nviE (E:)
    aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrvnaltlehypgmtekalaeivd
    earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkre
    atpegdrwvearesdqqaakrw