PDB entry 1nvg

View 1nvg on RCSB PDB site
Description: n249y mutant of the alcohol dehydrogenase from the archaeon sulfolobus solfataricus-tetragonal crystal form
Class: oxidoreductase
Keywords: ARCHAEON, ZINC, NAD(H) dependent, mutant, OXIDOREDUCTASE
Deposited on 2003-02-03, released 2003-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.196
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent alcohol dehydrogenase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: ADH OR SSO2536
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39462 (0-346)
      • engineered (248)
    Domains in SCOPe 2.06: d1nvga1, d1nvga2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nvgA (A:)
    mravrlveigkplslqeigvpkpkgpqvlikveaagvchsdvhmrqgrfgnlrivedlgv
    klpvtlgheiagkieevgdevvgyskgdlvavnpwqgegncyycrigeehlcdsprwlgi
    nfdgayaeyvivphykymyklrrlnaveaapltcsgittyravrkasldptktllvvgag
    gglgtmavqiakavsgatiigvdvreeaveaakragadyvinasmqdplaeirriteskg
    vdavidlnysektlsvypkalakqgkyvmvglfgadlhyhaplitlseiqfvgslvgnqs
    dflgimrlaeagkvkpmitktmkleeaneaidnlenfkaigrqvlip