PDB entry 1nv9

View 1nv9 on RCSB PDB site
Description: hemk, apo structure
Deposited on 2003-02-02, released 2003-05-27
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-27, with a file datestamp of 2003-05-27.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.242
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1nv9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nv9A (A:)
    gamdtrknvsgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgv
    spteekrilelvekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelir
    kygiktvadigtgsgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkg
    eflepfkekfasiemilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydt
    sgkivlmeigedqveelkkivsdtvflkdsagkyrflllnrrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nv9A (A:)
    kiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilelvek
    rasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtgs
    gaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasie
    milsnppyvkssalfeppealfggedgldfyreffgrydtsgkivlmeigedqveelkki
    vsdtvflkdsagkyrflllnrrss