PDB entry 1nv9

View 1nv9 on RCSB PDB site
Description: HemK, apo structure
Class: transferase
Keywords: Class I methyltransferase fold, TRANSFERASE
Deposited on 2003-02-02, released 2003-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemK protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: hemK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nv9a_
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nv9A (A:)
    gamdtrknvsgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgv
    spteekrilelvekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelir
    kygiktvadigtgsgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkg
    eflepfkekfasiemilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydt
    sgkivlmeigedqveelkkivsdtvflkdsagkyrflllnrrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nv9A (A:)
    kiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilelvek
    rasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtgs
    gaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasie
    milsnppyvkssalfeppealfggedgldfyreffgrydtsgkivlmeigedqveelkki
    vsdtvflkdsagkyrflllnrrss