PDB entry 1nv8

View 1nv8 on RCSB PDB site
Description: N5-glutamine methyltransferase, HemK
Class: transferase
Keywords: Class I AdoMet-dependent methyltransferase, TRANSFERASE
Deposited on 2003-02-02, released 2003-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemK protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: hemK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nv8a_
  • Chain 'B':
    Compound: hemK protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: hemK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nv8b_
  • Heterogens: SAM, MEQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nv8A (A:)
    gamdtrknvsgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgv
    spteekrilelvekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelir
    kygiktvadigtgsgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkg
    eflepfkekfasiemilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydt
    sgkivlmeigedqveelkkivsdtvflkdsagkyrflllnrrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nv8A (A:)
    rkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilelve
    krasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtg
    sgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasi
    emilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydtsgkivlmeigedq
    veelkkivsdtvflkdsagkyrflllnrrss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nv8B (B:)
    gamdtrknvsgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgv
    spteekrilelvekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelir
    kygiktvadigtgsgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkg
    eflepfkekfasiemilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydt
    sgkivlmeigedqveelkkivsdtvflkdsagkyrflllnrrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nv8B (B:)
    kiwslirdcsgklegvtetsvlevllivsrvlgirkedlfllgvspteekrilelvekra
    sgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtgsga
    igvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasiemi
    lsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydtsgkivlmeigedqvee
    lkkivsdtvflkdsagkyrflllnrrs